Remove domains Successfully! (Deleted: helperrevokedsafe.icu)

Updated domain list:

haus123.org , hausbetreuung.ch , hausderachtsamkeit.ch , hausecat.ru , hausemann.info , hauserandmiller.net , hauserandmiller.online , hauteautohire.pro , hauteautoroute.pro , hauteluxenoir.store , hautevoitures.pro , hautscrets77-cologny.ch , havad.tech , haval-km4.ru , haval-mos.ru , haval-zapchasti.ru , havalauto.sk , havalcar.sk , havalpark-kras.ru , havana88-c.xyz , havaroutleie.online , haveafield.day , havefunnow.org , havelontira.sbs , havely.net , havenba.club , havendusktide.sbs , havenhealthco.org , havenmirage.shop , havensbits.blog , havensilentharbor.site , havenweave.shop , havenweave.store , haveyoutrytocommitsuicide.com , havii.online , havii.ru , havoai.art , havoai.tech , havocflareonirixx.info , havocflarezonexix.info , hawaiiastateofmind.net , hawaiiastateofmind.shop , hawaiiastateofmind.store , hawaiiitsastateofmind.net , hawaiiitsastateofmind.shop , hawaiiitsastateofmind.store , hawaiinewbuilds.info , hawaiinewbuilds.org , haweir.online , hawgpit.net , hawker.today , hawklabs.icu , hawkrock.org , hawksautonationwide.store , hawksystem.org , hawktuah.foo , hawthornandhaven.store , hawuxo.info , haxis.shop , haxpc.org , haxtreme.live , haxyli.ru , hay11a.online , hay11thai.online , hay888.asia , hayaamodesty.store , hayabyrabicom.space , hayaserbrew.net , hayaserbrew.online , hayat.solutions , hayat.uno , hayatech.dev , hayatvera.net , hayawears.site , haydenm.design , hayjge.info , hayleyandaaron.club , hayozma.org , hayrolesea.life , hayrowen.mom , hayroxbest.xyz , haytinvaochinhminh.online , haywardbooktoaction.org , hayyallcompany.com , hayybi.org , hayzzbeauty.store , hazardousbridges.online , hazardstudios.store , hazelrosemcnutt.net , hazelwood-ginger-sorrel-myrtle.run , hazwpsj.website , hazxyj8.shop , hb08pr.top , hb0mt7.top , hb22ys.top , hb2m0i.cyou , hb6ko5.top , hb7.icu , hb88.global , hb886.blog , hb88vn.pro , hb8unm.top , hbadatadriven.org , hbaugeusg.store , hbcu.hockey , hbcubrick.org , hbcuhealthnetwork.info , hbcukitty.info , hbdywz.top , hbelektirik.online , hbf82t20.top , hbf82t21.top , hbf82t22.top , hbf82t23.top , hbf82t24.top , hbf82t25.top , hbf82t26.top , hbf82t27.top , hbf82t28.top , hbf82t29.top , hbf82t30.top , hbfqa.top , hbfxyvzk094.top , hbggshj.top , hbh.info , hbhongrun.net , hbhz8r.top , hbihm.info , hbjiujin.top , hbjl.art , hbjxmr.top , hbjykj.top , hbjzxx.top , hbl7nj.top , hblnyy.top , hblxi.top , hbmhcw.net , hbmhcw.vip , hbndq.top , hbomaxportugal.online , hbooksstore.shop , hbookyouss.shop , hbop.top , hboportugaloffer.online , hbp1up.shop , hbqsjx.net , hbqykm.asia , hbr.style , hbsj.xyz , hbstudio.cat , hbt5u0.top , hbtelecommunicationsllc.com , hbtiyu-tiyu.vip , hbtm.us , hbvtpgb.info , hbwcyy.top , hbxingyuan.shop , hbystjk.top , hbyulin.top , hc006.top , hc0hiqzihx4uqo8sa.xyz , hc28-furniture.ru , hc4foessa7jqmysfd.xyz , hc5gdrzsz40x080jf.xyz , hc63jktu.top , hc7mwmzm.top , hcarbon.info , hcautoalienados.site , hcazt.shop , hcbg5yb8rve2hg9av.xyz , hccdesign.net , hccpa.net , hcdesignx.site , hcdqw.pink , hceguard.site , hcfjxge4xzz3551rm.xyz , hcfvz.info , hcg-int.med , hcgfyz.cyou , hcgq1k8xbfdwdbps3.xyz , hcgswy121.vip , hcgzzz9the9peobaw.xyz , hch45jrgfkr2engib.xyz , hchag.ch , hchs-shelter.org , hciconline.live , hckc.tech , hckz.homes , hclmdh.icu , hclmdh.vip , hcm365.net , hcm66.org , hcmc.ing , hcmmj.xyz , hcng1q6u.top , hcniran.org , hconnect.run , hcoy8cjbyg.buzz , hcp-engage.net , hcpf2acppr.shop , hcstudy.org , hcsvs.com , hct-tw1.top , hct-tw2.top , hct6s2.top , hctp1004.top , hctpl.shop , hcw3jwt7.top , hcwxyr.yachts , hcxyxmi.shop , hcyl1.shop , hcyy.online , hd-smile.net , hd9v2.buzz , hdabla32.cfd , hdablac33.shop , hdasdn.site , hdatruckpride.online , hdcompany.pro , hddtvo.top , hddzqw5d.top , hdetyx3.shop , hdeuwgdehfc.asia , hdfghdfdfdfh.sbs , hdg8t8.top , hdghwtnm.top , hdhg.net , hdhi29.life , hdhi46.life , hdhsjsjdhdhjzjz.icu , hdjashd.net , hdkhatrimaza.cloud , hdkzrh.info , hdl1et.top , hdlin.dev , hdln.ru , hdmcna.boats , hdmjw.shop , hdmlbvhvz.boats , hdmovie2.boutique , hdmovie2.villas , hdmoviehub.pics , hdmovies.mom , hdmovies2.cyou , hdmovies4u.gift , hdmovies4u.pictures , hdmoviesfair.boats , hdmoviesflix.lol , hdmoviesflix.pics , hdmoviesflix.skin , hdmoviesonline.net , hdmpx.top , hdnnn.vip , hdnvk.top , hdoorncomics.com , hdp9uacu.top , hdsaony.website , hdscw.net , hdsfhe.site , hdsim.link , hdsubx33.shop , hduobp.top , hdwallpapersdl.net , hdztools.net , hdztools.online , hdztools.store , he-22.ru , he0jtt.top , he18qr.top , he1r0g.top , he3j.xyz , he3mpg72.world , he45.top , he57le.top , he6tsjz.top , head2025.top , headaiactionengine.org , headaiactionzone.org , headaiadbase.org , headaiadboost.org , headaiadclick.org , headaiadflow.org , headaiadgate.org , headaiadgroup.org , headaiadgrow.org , headaiadimpact.org , headaiadjoin.org , headaiadlead.org , headaiadlink.org , headaiadmark.org , headaiadmate.org , headaiadnote.org , headaiadpower.info , headaiadpower.org , headaiadpulse.info , headaiadpulse.org , headaiadscore.info , headaiadscore.org , headaiadshare.info , headaiadshare.org , headaiadshub.info , headaiadshub.org , headaiadslab.info , headaiadslab.org , headaiadsline.info , headaiadsline.org , headaiadslink.info , headaiadslink.org , headaiadslog.info , headaiadslog.org , headaiadsplus.info , headaiadsplus.org , headaiadspot.info , headaiadspot.org , headaiadsset.info , headaiadsset.org , headaiadstart.info , headaiadstart.org , headaiadsway.org , headaiadszone.info , headaiadszone.org , headaiadtouch.info , headaiadtouch.org , headaiadtrack.org , headaiadtrend.org , headaiadunion.org , headaiadvalue.org , headaiadview.org , headaiadvision.org , headaiadvoice.org , headaiadwave.org , headaiadworld.org , headaiagree.org , headaiagua.org , headaiaimflow.org , headaiaimhub.org , headaiaimlab.org , headaiaimline.org , headaiaimmax.org , headaiaimnow.org , headaiaimplus.org , headaiaimpro.org , headaiaimset.org , headaiaimway.org , headaiaimzone.org , headaiallyhub.org , headaiallylab.org , headaiallylink.org , headaiallymax.org , headaiallyplus.org , headaiallypro.org , headaiallyzone.org , headaialphazone.org , headaiapro.org , headaiaquazone.org , headaiassetzone.org , headaiastrozone.org , headaiatlas.org , headaiaudiozone.org , headaiauke.org , headaiaxiscore.org , headaiaxiszone.org , headaibanner.org , headaibase.org , headaibeamzone.org , headaibetazone.org , headaibiz.org , headaibizbase.org , headaibizboard.org , headaibizcore.org , headaibizengine.org , headaibizflow.org , headaibizhub.org , headaibizlab.org , headaibizline.org , headaibizlink.org , headaibizlog.org , headaibizmarket.org , headaibizmax.org , headaibiznow.org , headaibizpath.org , headaibizplus.org , headaibizpoint.org , headaibizpro.org , headaibizproject.org , headaibizroom.org , headaibizset.org , headaibizstep.org , headaibizstudio.org , headaibizsys.org , headaibiztrend.org , headaibizunion.org , headaibizwave.org , headaibizworld.org , headaibizzone.org , headaiblazezone.org , headaiblockzone.org , headaiboard.org , headaibomi.org , headaibondhub.org , headaibondlab.org , headaibondline.org , headaibondlink.org , headaibondlog.org , headaibondmax.org , headaibondnow.org , headaibondplus.org , headaibondpro.org , headaibondset.org , headaibondway.org , headaibondzone.org , headaibook.org , headaibrainzone.org , headaibrandhub.org , headaibrandline.org , headaibrandlink.org , headaibrandlog.org , headaibrandset.org , headaibrandway.org , headaibrandzone.org , headaibridge.org , headaibuzz.org , headaibuzzflow.org , headaibuzzhub.org , headaibuzzline.org , headaibuzzlink.org , headaibuzzlog.org , headaibuzzplus.org , headaibuzzset.org , headaibuzzsys.org , headaibuzzway.org , headaibuzzzone.org , headaicallhub.org , headaicalllab.org , headaicallline.org , headaicalllink.org , headaicalllog.org , headaicallnow.org , headaicallpro.org , headaicallset.org , headaicallway.org , headaicampaign.org , headaicard.org , headaicash.org , headaicashbase.org , headaicashboard.org , headaicashcore.org , headaicashengine.org , headaicashlink.org , headaicashmarket.org , headaicashpath.org , headaicashpoint.org , headaicashprogram.org , headaicashproject.org , headaicashroom.org , headaicashstep.org , headaicashstudio.org , headaicashtrack.org , headaicashtrend.org , headaicashunion.org , headaicashvision.org , headaicashwave.org , headaicashworld.org , headaicashzone.org , headaicasthub.org , headaicastline.org , headaicastlink.org , headaicastlog.org , headaicastplus.org , headaicastset.org , headaicastway.org , headaicastzone.org , headaicaya.org , headaichain.org , headaichannelzone.org , headaichatflow.org , headaichathub.org , headaichatlab.org , headaichatline.org , headaichatlink.org , headaichatlog.org , headaichatmax.org , headaichatnow.org , headaichatplus.org , headaichatpro.org , headaichatset.org , headaichatway.org , headaichatzone.org , headaicheck.org , headaiciar.org , headaicloudbase.org , headgear.cyou , headlesslionstoes.cymru , headlinedstrikes.shop , headlinr.app , headtoheel.org , heal-coin.store , heal.beer , healcommonline.com , healcrest.company , healday.org , healedmindshq.org , healersuccess.net , healersuccess.online , healersuccess.store , healfast.cfd , healing-ange.online , healingcanvas.art , healingcharlotte.com , healingglowmassage.site , healingretreats.care , healingwithoutwalls.org , heallthbalance.icu , heallthlab.icu , heallthtrack.icu , heallthy-meall.icu , heallthyday.icu , heallthyfood.icu , heallthyway.icu , healnexus.autos , healoutloud.org , healssva.online , healstead.cam , healstreet.homes , healswift.org , health-boutique.online , health-n-wealth.store , health-omega.shop , health-review-buy.shop , health-summit.online , health-summit.store , health3x.online , health4x.online , healthandbestvalue.shop , healthandcare.click , healthberth.makeup , healthbreaking.shop , healthcare-degree-23178.bond , healthcare-degree-38113.bond , healthcare-degree-39563.bond , healthcare-degree-51059.bond , healthcare-degree-52762.bond , healthcare-trends-61978.bond , healthcareplatform.network , healthcareupdate.info , healthchews.store , healthcore.group , healthdealcompare.com , healthdiet.org , healthdock.monster , healtheirx.icu , healthempire.space , healthessential.club , healthfolio.agency , healthforce.biz , healthforce.site , healthgaze.guru , healthgoodactive.bet , healthgoodactive.digital , healthgoodactive.life , healthgoodactive.shop , healthgoodactive.world , healthgoodcenter.bet , healthgoodcenter.digital , healthgoodcenter.life , healthgoodcenter.shop , healthgoodcenter.world , healthgoodcoach.bet , healthgoodcoach.digital , healthgoodcoach.life , healthgoodcoach.shop , healthgoodcoach.world , healthgoodcommunity.bet , healthgoodcommunity.digital , healthgoodcommunity.life , healthgoodcommunity.shop , healthgoodcommunity.world , healthgoodliving.bet , healthgoodliving.digital , healthgoodliving.shop , healthgoodliving.world , healthgoodnutrition.bet , healthgoodnutrition.digital , healthgoodnutrition.life , healthgoodnutrition.shop , healthgoodnutrition.world , healthgoodonline.bet , healthgoodonline.digital , healthgoodonline.life , healthgoodonline.shop , healthgoodpath.bet , healthgoodpath.digital , healthgoodpath.life , healthgoodpath.shop , healthgoodpath.world , healthgoodplus.bet , healthgoodplus.digital , healthgoodplus.life , healthgoodplus.shop , healthgoodplus.world , healthgoodsolutions.bet , healthgoodsolutions.digital , healthgoodsolutions.life , healthgoodsolutions.shop , healthgoodsolutions.world , healthgoodtherapy.bet , healthgoodtherapy.digital , healthgoodtherapy.life , healthgoodtherapy.shop , healthgoodtherapy.world , healthgoodtoday.bet , healthgoodtoday.digital , healthgoodtoday.life , healthgoodtoday.shop , healthgoodtoday.world , healthgoodwellness.digital , healthgoodwellness.life , healthgoodwellness.shop , healthgoodwellness.world , healthgoodworks.bet , healthgoodworks.digital , healthgoodworks.life , healthgoodworks.shop , healthgoodworks.world , healthgoodzone.bet , healthgoodzone.digital , healthgoodzone.life , healthgoodzone.shop , healthgoodzone.world , healthguards.org , healthiercommunitiesthroughsaferchemistry.com , healthiercommunitiesthroughsaferchemistry.net , healthiercommunitiesthroughsaferchemistry.us , healthiermeherts.org , healthinsiurance.site , healthline.tech , healthloom.forum , healthmatrix.forum , healthmatters.fit , healthmax.space , healthmeds.store , healthmorenew.site , healthnest.club , healthnexa.site , healthnfitness.info , healthnook.work , healthofcare.biz , healthology.store , healthoracle.fun , healthportreviews.online , healthpulse.mom , healthquizdaily.org , healthreviewshub.blog , healthrooted.shop , healthsa.site , healthscan.bio , healthsciencesinstitute.tech , healthsilo.coupons , healthsolutionsandweightloss.net , healthspaninsight.store , healthspring.site , healthspringetc.info , healthspringhub.info , healthspringplus.info , healthspringpro.info , healthspringzone.info , healthstory.care , healthstudy.ru , healthtem.site , healthtunecx.info , healthtuneetc.info , healthtunepro.info , healthtunezone.info , healthy-babies.ru , healthy-future.sk , healthyaesthics.net , healthyaesthics.shop , healthyaesthics.store , healthyaspossiblefoundation.online , healthybabies.ru , healthybridge.online , healthycommunitiesthroughsaferchemistry.com , healthycommunitiesthroughsaferchemistry.net , healthycommunitiesthroughsaferchemistry.us , healthyeveryday.click , healthyglowway.space , healthygreenhomes.info , healthyhearingnetwork.store , healthyhub.cyou , healthylifechoice.beauty , healthylifereviews.online , healthylivingg.site , healthylocals.org , healthymindspsychiatricservice.info , healthymindspsychiatricservice.org , healthynomads.us , healthypathway.space , healthypetfood.store , healthyrhythm.space , healthyroot.online , healthyself.computer , healthytip.live , healthyway.space , healthyyouandi.net , healu.fit , healuz.digital , healuz.life , healuz.online , healuz.pet , healuz.site , healuz.world , healway.pro , healwing.boats , heamot.digital , heanewshealth.shop , heapwellgloves.shop , hearclean.pro , hearingcareclinic.net , heartbeatprimarycare.org , heartbidxmlfeed.monster , heartchakra.org , heartdreamframesnow.watch , heartearthgreenframe.motorcycles , heartforgood.blog , heartframeglowthunder.skin , heartgarment.store , heartglowhub.net , heartglowhub.shop , heartglowhub.store , hearthandhue.art , hearthcraft.shop , hearthealthymethod.info , hearthealthymethod.org , hearthome.online , hearthspace.info , hearthushmakerforest.skin , heartlesshype.shop , heartlinnk.info , heartly-1.ru , heartmindillumination.org , heartofcheddar.org , heartofgoldjin.top , heartpawcompabnion.com , heartrate.life , heartscan.bio , heartse.online , heartsoftearthblue.motorcycles , heartsync404.info , hearttoartcollective.org , heartumental.fun , heast-hank-urde.site , heat-flex.store , heatbaking.info , heatbakingcompany.info , heatburst.cfd , heateam.ee , heatherscountrychicboutique.com , heathewellnessgym.info , heatshock.biz , heatsim.cfd , heatspace.shop , heattrx.cfd , heattx.cfd , heaven-of-clicks.sbs , heavendexnewsjournal.blog , heaveninabite.shop , heavenlycreationschildcare.org , heavenlygardenfoundation.org , heavenlyhogsq.online , heavenlyhustle.store , heavenlypearlhomecare.org , heavenlyshoulder.info , heavenofclick.sbs , heavenofclick.world , heavenofclicksnow.lat , heavenofclicksnow.sbs , heavenofclx.lat , heavenofclx.world , heavenorderfood.us , heavensofclicks.lat , heavensofclicks.world , heaver.pics , heaviegtic.org , heavymotions.net , heavyshell.online , heazak.click , hebergeur-fivem.net , hebesportjewelry.net , hebrk.top , hechanova.dev , hechoenmallorca.org , hectic.top , hecto.finance , hectorvelarealtor.com , hed2ql76rg5us.shop , hedager.online , hederafinance.info , hederafinance.site , hedex.trade , hedgecore.cfd , hedgersguu.org , hedgex.trade , hedkxh2.shop , hedojusun.pro , hedoneiz.site , hedonism-therapy.ru , hedui.shop , hee.baby , hee.forsale , hee.kids , hee.mom , hee.pink , heedideograph.club , heeds.xyz , heelixsoles.shop , heello0000.sbs , heew4.shop , hefasttrackob.ru , hefasttrackob.store , hefengzhishui.top , hefnoy.top , hefriu.online , hefriu.ru , hegapoi1.pro , hegtb.pink , hegzaf.click , hehealthfoodst.shop , hehege.fun , hehege.sbs , hehonglei.top , heidelberg.management , heidenfeld.net , heidou.site , heightstowers.net , heikepeixun.net , heiliaotp.sbs , heimplanet.shop , heimwald.net , heineck.xyz , heinesch.dev , heirluum.app , heisters.shop , heixiaomao.top , heizking.net , heji668.vip , hejjlp.info , hekalu.solutions , hekmaa.space , hekunekow.pro , helalinki.info , helan.love , helbergchill.cfd , helbertfund.cfd , helbringao.cfd , heldday.cyou , helder-valtrix.net , heldermen.ch , helenafloresjardins.shop , helenamedicare.site , helenatherton.xyz , helenauelsmann.info , helennailsbeauty.site , heliade-editions.online , heliade-editions.store , helianthus.site , helibupensgu.shop , helic-co.info , helic.info , helicrecruitment.info , helicsolutions.info , helicsolutions.org , helio.asia , helio.business , helionavira.sbs , heliosintelligence.online , heliosintelligencedaffaires.technology , heliosmoon.shop , helioswatch.shop , heliotoken.buzz , heliotoken.site , heliqentraso.sbs , helitop.shop , helium.quest , heliwangwang.top , helixcare.store , helixor.cfd , hell.cafe , hellastyle.shop , hellcases.site , hellhouse3d.shop , hellinger.ch , hello-ege.ru , helloalignmind.org , hellobooksd.shop , helloboosleepwear.shop , hellochameleon.us , hellocomfortac.com , hellod9.ru , hellodear.care , hellofuture.work , hellohashtagclean.info , hellokittytf.cfd , helloonepromissory.info , hellopath.cloud , hellosmooth.us , hellovidesh.click , helloww88xyz.buzz , hellpful.online , hellsangels.space , helmetbankthailand.org , helmetguess.shop , helmsmen.group , helo88.pink , helontrix.store , helovesyou.life , help-biii-streaming.info , help22.net , help4commerce.com , helpaccess.net , helpavtoshkolashop.store , helpcentercxassist.info , helpcxassist.info , helpdeftco.cfd , helpdesk.company , helpdeskcxassist.info , helpdobrimpeople.click , helpedelectronic.shop , helper-wow.ru , helpflyer.online , helpforheroes.net , helpforlittlemasondavis.site , helpfoundation.site , helphealthtoday.online , helphelp.help , helphospitalemployeeslinkingwithpatients.net , helphospitalemployeeslinkingwithpatients.online , helphospitalemployeeslinkingwithpatients.store , helping-hands.se , helpinghandhc.org , helpmebro.xyz , helpmecode.org , helpmedicalsuppliess.shop , helpp.net , helpphilippines.site , ,