Remove domains Successfully! (Deleted: h653.lat)
Updated domain list:
gzrpbep.shop
,
gzrunzhi.com
,
gzsdaozhi.com
,
gzsddq.com
,
gzsfxc.com
,
gzsszx.com
,
gzsvwr.shop
,
gzt5a6.icu
,
gztayrn.shop
,
gztbp944.com
,
gztiansai.org
,
gztrgm.com
,
gztspw.com
,
gzu47.top
,
gzunt.com
,
gzutnj.bar
,
gzveby.info
,
gzvictoriahotels.com
,
gzvqv5.shop
,
gzvzlo.site
,
gzwdwj.com
,
gzwega.com
,
gzwg.top
,
gzwslp.top
,
gzwubian.com
,
gzxiaolei.com
,
gzxjsh.com
,
gzxjy168.com
,
gzyhls.com
,
gzyitong.com
,
gzykzl.top
,
gzyljdp.com
,
gzyskjsj.com
,
gzzb.top
,
gzzhongtai.com
,
gzzllm.com
,
gzzpjx.com
,
h-1bvisaadvisor.com
,
h-1bvisaattorney.com
,
h-1bvisaconsultant.com
,
h-201.com
,
h-and-h.top
,
h-cio.ch
,
h-d.sk
,
h-decoration.ru
,
h-huisuo.wiki
,
h-jiaoll.wiki
,
h-jioasq.wiki
,
h-k-aa.online
,
h-kisyou.com
,
h-kut.com
,
h-liaowanggf.wiki
,
h-live-jiuyou.com
,
h-och-events.ch
,
h-p.tech
,
h-paintingservices.com
,
h-s-s.ch
,
h-shipin.wiki
,
h-tvboxoficial.com
,
h-u-o-c.com
,
h-ud.com
,
h-waiyucheng.com
,
h-winners.com
,
h00ku.top
,
h01-dev.app
,
h036n.top
,
h04g23e.shop
,
h08ucuuugt4.vip
,
h0gx5i.shop
,
h0krkov.site
,
h0lhd.top
,
h0lzed.ru
,
h0r1a5.shop
,
h0sp7.top
,
h0u0z97.shop
,
h0umh3.shop
,
h0wtl.top
,
h0x4ic2mi3p0.site
,
h0xhq.top
,
h0zra.shop
,
h0zwe.top
,
h12lw.top
,
h15ej807ac.baby
,
h15exwp1001.baby
,
h15ip.top
,
h16ki114km.baby
,
h16wknm533.baby
,
h17ihtl150.baby
,
h19xo738vb.baby
,
h1aohi.icu
,
h1bdaf.shop
,
h1bvisaadvisor.com
,
h1bvisaconsultant.com
,
h1c5lc.site
,
h1df8.top
,
h1fc.com
,
h1forecast.com
,
h1gvjnf.beer
,
h1j4r.shop
,
h1j510jg.com
,
h1jhkj3.site
,
h1n58.top
,
h1obqd.shop
,
h1p55.top
,
h1rq783vt.baby
,
h1sr2wi.bond
,
h1st70.shop
,
h1tc61lg.baby
,
h1tm4n.ru
,
h1ugx.top
,
h1wkg.top
,
h1y74.shop
,
h2-3066.com
,
h2-tabs.com
,
h2.money
,
h20n6.cfd
,
h20sj718lf.baby
,
h22pjm1mr6fj.site
,
h23l3.top
,
h24vv883uh.baby
,
h2575r.com
,
h26fiy.shop
,
h2777.club
,
h2777.live
,
h2777.net
,
h2777.vip
,
h28ev5m5wp.top
,
h2aa7.shop
,
h2bd338.shop
,
h2bmg.top
,
h2bo1.top
,
h2bridge.net
,
h2ckheva.top
,
h2d25.top
,
h2hydrate.com
,
h2kfilm.com
,
h2ltx.top
,
h2m-recycling.com
,
h2olabstudio.com
,
h2olabstudio.net
,
h2otech.site
,
h2sa.com
,
h2sdrv.shop
,
h2t2e.top
,
h2tabs.net
,
h2techsolucoes.com
,
h2titans.com
,
h2trade.ch
,
h2txmsp.site
,
h2umu.shop
,
h2v4.cfd
,
h2v7.republican
,
h2vbqj.shop
,
h2w4j.info
,
h2w5e.top
,
h2watertab.com
,
h2watertabs.com
,
h2ws8.top
,
h2xx7r.shop
,
h2zh6.cyou
,
h3-c.com
,
h3319.com
,
h33ut.top
,
h3464atc.top
,
h3567.com
,
h368.xyz
,
h384743h.click
,
h38f2.top
,
h38f9j4.com
,
h3a-baisha-jiasuqi.com
,
h3a-free-jiasuqi.com
,
h3a-game-jiasuqi.com
,
h3a-haiou-vpn.com
,
h3a-kuaimiao-vpn.com
,
h3a-sanjiecao-vpn.com
,
h3a-sijiecao-vpn.com
,
h3a-tizijiasu.com
,
h3a-vpn-lite.com
,
h3bet.blog
,
h3byo.top
,
h3d7.sbs
,
h3e90a8a6tbck.shop
,
h3fz2y.icu
,
h3jx1nw.bond
,
h3ktdlf.site
,
h3og3.top
,
h3ptm.top
,
h3qdryc.shop
,
h3qgf.top
,
h3qvg.top
,
h3x2lf.shop
,
h3y77.shop
,
h3ytf.top
,
h3zroblox.com
,
h3zsqm858.baby
,
h41axohf.app
,
h435.xyz
,
h43gv162ks.baby
,
h43jw104mp.baby
,
h43whty879.baby
,
h43ww177dw.baby
,
h45bh328bm.baby
,
h45civh311.baby
,
h46fi183wt.baby
,
h472v6uu.shop
,
h47rq198ox.baby
,
h48ht831tp.baby
,
h48oye.shop
,
h4b214jg.com
,
h4bfp5.shop
,
h4blxob.site
,
h4gknj7.site
,
h4jcn4.shop
,
h4o22c0n.shop
,
h4oa5zr.shop
,
h4ru.dev
,
h4sec.com
,
h4tt8q.site
,
h4u.se
,
h4us362ca.baby
,
h4v3.bar
,
h4x2zn.info
,
h4x2zo.info
,
h4z81.shop
,
h4z8m.com
,
h5-app-sports9you.com
,
h5-madou.com
,
h5-new-ayxsport.com
,
h5-vip-ayx.com
,
h5-zh-aiyouxiesport.com
,
h5-zh-aiyouxiesports.com
,
h5-zh-ayxgame.com
,
h5-zh-jiuyouesport.com
,
h5-zh-jiuyouesports.com
,
h503.lat
,
h505.lat
,
h506.lat
,
h507.lat
,
h508.lat
,
h509.lat
,
h50id.top
,
h510.lat
,
h511.lat
,
h514.lat
,
h515.lat
,
h517.lat
,
h518.lat
,
h519.lat
,
h520.lat
,
h521.lat
,
h522.lat
,
h523.lat
,
h524.lat
,
h525.lat
,
h526.lat
,
h527.lat
,
h529.lat
,
h530.lat
,
h531.lat
,
h532.lat
,
h533.lat
,
h534.lat
,
h535.lat
,
h536.lat
,
h537.lat
,
h539.lat
,
h53fh484si.baby
,
h540.lat
,
h541.lat
,
h542.lat
,
h543.lat
,
h544.lat
,
h545.lat
,
h546.lat
,
h547.lat
,
h548.lat
,
h549.lat
,
h550.lat
,
h551.lat
,
h552.lat
,
h553.lat
,
h554.lat
,
h555.lat
,
h556.lat
,
h557.lat
,
h558.lat
,
h55betq.com
,
h560.lat
,
h561.lat
,
h562.lat
,
h563.lat
,
h564.lat
,
h565.lat
,
h566.lat
,
h567.lat
,
h568.lat
,
h569.lat
,
h56fwxv862.baby
,
h570.lat
,
h571.lat
,
h5718.com
,
h573.lat
,
h574.lat
,
h575.lat
,
h576.lat
,
h577.lat
,
h578.lat
,
h579.lat
,
h57ge.top
,
h580.lat
,
h581.lat
,
h582.lat
,
h583.lat
,
h584.lat
,
h585.lat
,
h586.lat
,
h587.lat
,
h588.lat
,
h589.lat
,
h58mipr.site
,
h590.lat
,
h591.lat
,
h592.lat
,
h593.lat
,
h594.lat
,
h595.lat
,
h596.lat
,
h5966.com
,
h597.lat
,
h598.lat
,
h599.lat
,
h5avrd.bond
,
h5axkx.shop
,
h5bet-8.com
,
h5brio.click
,
h5d7h.top
,
h5ffgl.shop
,
h5jolt.click
,
h5ljrr.site
,
h5lume.click
,
h5msk3.shop
,
h5nexa.click
,
h5nimble.click
,
h5pico.click
,
h5pyp.top
,
h5ru.online
,
h5sudamerica.com
,
h5sudamerica.online
,
h5sudamerica.store
,
h5tapfun.pro
,
h5v8xn.info
,
h5v8xo.info
,
h5xxpay.bet
,
h5zora.click
,
h600.lat
,
h601.lat
,
h602.lat
,
h603.lat
,
h604.lat
,
h605.lat
,
h606.lat
,
h607.lat
,
h608.lat
,
h609.lat
,
h60er561ok.baby
,
h60onws348.baby
,
h610.lat
,
h611.lat
,
h612.lat
,
h613.lat
,
h614.lat
,
h615.lat
,
h616.lat
,
h617.lat
,
h618.lat
,
h619.lat
,
h620.lat
,
h621.lat
,
h622.lat
,
h623.lat
,
h624.lat
,
h625.lat
,
h626.lat
,
h627.lat
,
h628.lat
,
h629.lat
,
h62mmz.beer
,
h62uw137om.baby
,
h630.lat
,
h631.lat
,
h632.lat
,
h635.lat
,
h636.lat
,
h637.lat
,
h638.lat
,
h63xp6.top
,
h640.lat
,
h642.lat
,
h643.lat
,
h644.lat
,
h645.lat
,
h646.lat
,
h647.lat
,
h648.lat
,
h649.lat
,
h651.lat
,
h652.lat
,
h654.lat
,
h655.lat
,
h657.lat
,
h658.lat
,
h659.lat
,
h660.lat
,
h661.lat
,
h662.lat
,
h663.lat
,
h664.lat
,
h665.lat
,
h666.lat
,
h668.lat
,
h669.lat
,
h6691.com
,
h66dzbr554.baby
,
h66iq676pk.baby
,
h66vm.com
,
h670.lat
,
h671.lat
,
h672.lat
,
h673.lat
,
h674.lat
,
h677.lat
,
h679.lat
,
h67ad3.bond
,
h67ubrj917.baby
,
h681.lat
,
h682.lat
,
h683.lat
,
h685.lat
,
h686.lat
,
h687.lat
,
h688.lat
,
h689.lat
,
h68pm611gm.baby
,
h690.lat
,
h691.lat
,
h692.lat
,
h693.lat
,
h694.lat
,
h695.lat
,
h696.lat
,
h698.lat
,
h699.lat
,
h69a.xyz
,
h69b.xyz
,
h69c.xyz
,
h69d.xyz
,
h69e.xyz
,
h69g.xyz
,
h69h.xyz
,
h69i.xyz
,
h69j.xyz
,
h69k.xyz
,
h69l.xyz
,
h69m.xyz
,
h69ozwc1092.baby
,
h6awzec.shop
,
h6dztgu.site
,
h6h5okp0.top
,
h6iaty.shop
,
h6lip.top
,
h6mt.xyz
,
h6p1.click
,
h6pt3u.work
,
h6qh1.top
,
h6r7zn.info
,
h6r7zo.info
,
h6y5b.top
,
h700.lat
,
h701.lat
,
h702.lat
,
h70bf.shop
,
h71nhz.site
,
h72ay.shop
,
h72pz306yb.baby
,
h73ctu.info
,
h749jr0.com
,
h75b6.top
,
h772p.top
,
h79wqts320.baby
,
h7aglobal.com
,
h7b2pn.site
,
h7dyl.top
,
h7e0i.top
,
h7fld7l.beer
,
h7frhdkr.icu
,
h7k.xyz
,
h7r1.com
,
h7uh9h.site
,
h7vju.top
,
h7x23r7.shop
,
h80dz.top
,
h83ns6.shop
,
h85h.com
,
h85h5.top
,
h86tx.top
,
h87gs.top
,
h888999.com
,
h88b.net
,
h88toxe152.baby
,
h8c3h5.shop
,
h8kpy.work
,
h8qxp.top
,
h8rd1g.shop
,
h8t6.com
,
h8t7pch8.icu
,
h8v2.motorcycles
,
h8v78dz.com
,
h8xml.top
,
h8ykb.shop
,
h8z27.top
,
h9048w.beer
,
h90tjqn728.baby
,
h91mg6ax.baby
,
h91njgu426.baby
,
h91skdp279.baby
,
h92deuc174.baby
,
h95666.com
,
h95dl335iy.baby
,
h98bn992qh.baby
,
h9frrn.site
,
h9g9.com
,
h9plq7.xyz
,
h9t2.motorcycles
,
h9t2.sbs
,
h9t3.boats
,
h9v3.com
,
h9vt3sk.online
,
h9w8fq.site
,
h9wy23.com
,
h9x97lhf.app
,
ha-boedefeld.com
,
ha2tim.com
,
ha4ypxej5b.top
,
ha6il.com
,
ha70hwi.site
,
haaaib.info
,
haaaopq.vip
,
haacdc.com
,
haadii.com
,
haagi.art
,
haaiyes.info
,
haakeskeepsakes.com
,
haanjameheehitus.ee
,
haaqku.com
,
haarcare.com
,
haarcare.store
,
haardsfeer.com
,
haarlem.events
,
haarlemcity.info
,
haarlemcity.org
,
haarsystem.com
,
haasjhotel.com
,
haatech.net
,
haatsowaakye.com
,
habanerosystemsq.com
,
habaseven.com
,
habasit360.com
,
habcan.com
,
habcoorigins.com
,
habeebshittu.com
,
habeltoto.org
,
habenero88.com
,
habenodernichthaben.org
,
haberkulis.org
,
haberportalim.xyz
,
habeshagoldenway.com
,
habi88.com
,
habiary.com
,
habibbank.us
,
habibi.exchange
,
habibi9.com
,
habibicometobali.com
,
habibjee.store
,
habibtatmicrob.com
,
habinassportinggoods.com
,
habinsure.com
,
habit1.xyz
,
habit123.xyz
,
habit777.xyz
,
habitair.xyz
,
habitape.xyz
,
habitartesalud.com
,
habitasindicos.info
,
habitasindicos.org
,
habitat888.xyz
,
habitatdeai.xyz
,
habitatlrt.xyz
,
habitatodds.xyz
,
habitatrapid.org
,
habitatrestake.xyz
,
habitatsex.xyz
,
habitatsfractionalize.xyz
,
habitatslrt.xyz
,
habitatss.xyz
,
habitatsxxx.xyz
,
habitattokenize.xyz
,
habitatxxx.xyz
,
habitatyeg.com
,
habitev.xyz
,
habithacker.xyz
,
habithero-hackcreate.com
,
habitila.com
,
habitloop.store
,
habitlrt.xyz
,
habitnet.link
,
habitodds.xyz
,
habitplate.com
,
habits123.xyz
,
habits777.xyz
,
habits8.xyz
,
habits88.xyz
,
habits888.xyz
,
habitschool.xyz
,
habitsex.xyz
,
habitsfractional.xyz
,
habitslot.xyz
,
habitslrt.xyz
,
habitspets.xyz
,
habitsporn.xyz
,
habitsrestake.xyz
,
habitss.xyz
,
habitsscan.xyz
,
habitssite.xyz
,
habitssync.xyz
,
habitstalk.xyz
,
habitstokenization.xyz
,
habitstokenize.xyz
,
habitsvpn.xyz
,
habitswrite.xyz
,
habitsxxx.xyz
,
habitteam.xyz
,
habittokenization.xyz
,
habittool.xyz
,
habitualmart.shop
,
habituu.store
,
habitvalue.xyz
,
habitview.xyz
,
habiubiusmart.com
,
habiye.com
,
hablatuqueyointerpreto.online
,
habtrieste.com
,
habumoa.com
,
haccamlarbirligi.com
,
hachain.xyz
,
hachat.xyz
,
hachikujo-master.com
,
haciendametapan.com
,
haciendaojodeagua.club
,
haciendasoldelmar.com
,
haciendasoldelmar.net
,
hacioglumadeniyag.online
,
hack-bit.com
,
hackandhammerdiy.com
,
hackbit.app
,
hackbit.live
,
hackbit.net
,
hackbit.news
,
hackbitllc.com
,
hackcatalog.xyz
,
hackeditor.xyz
,
hackel-motoculture.com
,
hackensackedexcellence.com
,
hackerbet.xyz
,
hackerboost.com
,
hackerddos.com
,
hackerfitness.store
,
hackerfractionalize.xyz
,
hackergirls.online
,
hackerinfo.xyz
,
hackerloan.xyz
,
hackermaker.xyz
,
hackerpet.xyz
,
hackerpets.xyz
,
hackerrobot.xyz
,
hackers-edge.com
,
hackertalk.xyz
,
hackerxxx.xyz
,
hackfeldrealestate.com
,
hackgateway.xyz
,
hackhacker.xyz
,
hackhou.se
,
hacking123.xyz
,
hacking777.xyz
,
hacking88.xyz
,
hackingair.xyz
,
hackingape.xyz
,
hackingauth.xyz
,
hackingcash.xyz
,
hackingdeai.xyz
,
hackingev.xyz
,
hackingfx.xyz
,
hackinginfo.xyz
,
hackinglist.xyz
,
hackingloan.xyz
,
hackingmart.xyz
,
hackingneo.xyz
,
hackingpay.xyz
,
hackingpet.xyz
,
hackingpets.xyz
,
hackingporn.xyz
,
hackingrush.xyz
,
hackingsocialfi.xyz
,
hackingsync.xyz
,
hackingtalk.xyz
,
hackingview.xyz
,
hackingxxx.xyz
,
hackinspire.com
,
hacklantis.com
,
hackli.site
,
hackmixer.xyz
,
hacknexus.xyz
,
hackodds.xyz
,
hackpet.xyz
,
hackpets.xyz
,
hacksbit.com
,
hacksovereign.xyz
,
hackstyle.xyz
,
hacktalk.xyz
,
hackthompson.pro
,
hacktok.site
,
hacktokenize.xyz
,
hackverseasia.com
,
hackview.xyz
,
hackworthlabs.com
,
hackwriting.xyz
,
hackxxx.xyz
,
hackyeah2025.online
,
hackyoursoul.com
,
haclub.xyz
,
hacode.xyz
,
hacomputer.xyz
,
haconnect.xyz
,
hacoofficial.com
,
hacookol.com
,
hacreator.xyz
,
had92i.com
,
hadacare-takasaki.com
,
hadalygenius.us
,
hadalysuccess.us
,
hadapp.xyz
,
hadapps.xyz
,
hadbot.xyz
,
hadbots.xyz
,
haddywins.com
,
hades.com.la
,
hadesign.xyz
,
hadesigns.xyz
,
hadeveloper.xyz
,
hadiahkaskus.com
,
hadiahmewah.top
,
hadiahunik.top
,
hadichraim.com
,
hadigital.xyz
,
hadikeji.top
,
hadithini.com
,
hadiushleather.com
,
hadiway.store
,
hadiya.dev
,
hadiyabloom.com
,
hadleycrawfordart.com
,
hadlisofpdcres.com
,
hadlynow.us
,
hadlyplus.us
,
hadntagent.xyz
,
hadntagi.xyz
,
hadntai.xyz
,
hadntbot.xyz
,
hadntbots.xyz
,
hadntgpt.xyz
,
hadong-dev.space
,
hadoperator.xyz
,
hadrlan-inc.com
,
hadrop.xyz
,
haeditor.xyz
,
haegdzbt.top
,
haequiposdebombeo.com
,
haerbinxingxi.xyz
,
haethereum.xyz
,
haevesthub.tech
,
haexecutive.com
,
haf3ha2do8gr9p-rvn16.com
,
hafactory.xyz
,
hafarming.xyz
,
hafeditions.com
,
haffitsed.online
,
hafila.com
,
hafinancialconsultancy.com
,
hafizorganics.com
,
hafizscientificcorporation.com
,
hafizskillservices.com
,
hafizzida.com
,
hafnerinvestments.com
,
hafnerinvestments.net
,
hafnerinvestments.shop
,
hafpixels.com
,
haftaevex.com
,
haftalikalisveriskampanyasiyakalamaca.cfd
,
haftaninenguzelmarketalisveriskeyfi.cfd
,
haftaninyildizlariiburadaa.com
,
hafunding.xyz
,
hafuviyituxu.sbs
,
hag7bjgq.top
,
hagakure-nakasu.com
,
hagambling.xyz
,
hagamefi.xyz
,
hagaseisaku.com
,
hagateway.xyz
,
hagdananstepsofservice.org
,
hagemah.ch
,
hagemah.org
,
hagenerator.xyz
,
hageqe.com
,
hageynq816.vip
,
haggardagi.xyz
,
haggishill.com
,
haggishnesss.space
,
hagiela.com
,
haglatentassot.fun
,
haglinater.ru
,
haglobal.xyz
,
hagositios.com
,
hagpjpx.shop
,
hagroup.xyz
,
haguantf.com
,
haguecapital.com
,
haha26125.com
,
haha9527.vip
,
hahacker.xyz
,
hahah.cfd
,
hahah.icu
,
hahah1.sbs
,
hahaha-goodone.com
,
hahahah.cfd
,
hahahah.sbs
,
hahanetwork.com
,
hahash.xyz
,
hahaup.site
,
hahealth.xyz
,
hahn-immoiblien.net
,
hahnspena.com
,
hahodl.xyz
,
hahold.xyz
,
hahugi.world
,
hai-jiaoshequbjb.wiki
,
hai-jiaowang.wiki
,
haibooka.com
,
haicar.top
,
haidajiaoyu.com
,
haiderkhalil.com
,
haiderlands.com
,
haidmcc.com
,
haifee.com
,
haifuns.com
,
haightorade.com
,
haihaim.shop
,
haihaisucaiku.com
,
haij-qingzaixiang.wiki
,
haijiao-bbs4.wiki
,
haijiao-daoh2.wiki
,
haijiao-qing22.wiki
,
haijiao-she4.wiki
,
haijiao-shequ33.wiki
,
haijiao-shequwyebrk.wiki
,
haijiao-top4.wiki
,
haijiao-touqinglt33.wiki
,
haijiao-wang4.wiki
,
haijiaod-ashen.wiki
,
haijiaoh-uanqi.wiki
,
haijiaokuntantou-p.wiki
,
haijiaoluan-tz.wiki
,
haijiaoluanl-un.wiki
,
haijiaoluanlunsheq-u.wiki
,
haijiaopoj-ie.wiki
,
haijiaoq-ing.wiki
,
,